Proteintech, 32800-1-AP, ELL2 Polyclonal antibody

Size: 20ul / 150ul The ELL2 (32800-1-AP) by Proteintech is a Polyclonal antibody targeting ELL2 in WB, ELISA applications with reactivity to human samples 32800-1-AP targets ELL2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information ELL2 (Elongation Factor for RNA Polymerase II 2) is a key transcriptional elongation factor that regulates RNA polymerase II (Pol II) during mRNA synthesis (PMID: 34265249). It belongs to the ELL gene family, which includes ELL1, ELL2, and ELL3, and plays a crucial role in controlling the elongation phase of transcription (PMID: 9108030). ELL2 is an androgen-responsive gene that is expressed by prostate epithelial cells and is frequently down-regulated in prostate cancer (PMID: 29179998). The predicted molecular weight of the ELL2 protein is 72 kDa, but due to post-translational modifications, its molecular weight is approximately 90 kDa. (PMID: 39582094, PMID: 34948391) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag39224 Product name: Recombinant human ELL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 393-515 aa of BC028412 Sequence: NSNSNSPSTPEGRGTQDLPVDSFSQNDSIYEDQQDKYTSRTSLETLPPGSVLLKCPKPMEENHSMSHKKSKKKSKKHKEKDQIKKHDIETIEEKEEDLKREEEIAKLNNSSPNSSGGVKEDCT Predict reactive species Full Name: elongation factor, RNA polymerase II, 2 Calculated Molecular Weight: 640 aa, 72 kDa Observed Molecular Weight: 80-90 kDa GenBank Accession Number: BC028412 Gene Symbol: ELL2 Gene ID (NCBI): 22936 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00472 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.