Proteintech, 32840-1-AP, CATSPERE Polyclonal antibody

Size: 20ul / 150ul The CATSPERE (32840-1-AP) by Proteintech is a Polyclonal antibody targeting CATSPERE in WB, ELISA applications with reactivity to human, mouse, rat samples 32840-1-AP targets CATSPERE in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HepG2 cells, mouse liver tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Cation channel sperm-associated auxiliary subunit epsilon (CATSPERE) is a critical component of the CatSper calcium channel complex, essential for sperm function and male fertility. CATSPERE interacts with the pore-forming subunits and contributes to the stability and function of the entire CatSper complex (PMID: 39605618). This complex is crucial for sperm capacitation, which includes the development of hyperactivated motility and the acrosome reaction, necessary for successful fertilization (PMID: 17330112; 18508611; 29707693). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36791 Product name: Recombinant human C1orf101 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 600-804 aa of BC032859 Sequence: DKGEALTVWTQIVYPENTGLYVIVESYGPKILQESHEISFEAAFGYCTKTLTLTFYQNVDYERISDYFETQDKHTGLVLVQFRPSEYSKACPIAQKVFQIAVGCDDKKFIAIKGFSKKGCHHHDFSYVIEKSYLRHQPSKNLRVRYIWGEYGCPLRLDFTEKFQPVVQLFDDNGYVKDVEANFIVWEIHGRDDYSFNNTMAQSGC Predict reactive species Full Name: chromosome 1 open reading frame 101 Calculated Molecular Weight: 110 kDa Observed Molecular Weight: 110 kDa GenBank Accession Number: BC032859 Gene Symbol: C1orf101 Gene ID (NCBI): 257044 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q5SY80 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.