Iright
BRAND / VENDOR: Proteintech

Proteintech, 32857-1-AP, APOBEC1 Polyclonal antibody

CATALOG NUMBER: 32857-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The APOBEC1 (32857-1-AP) by Proteintech is a Polyclonal antibody targeting APOBEC1 in WB, ELISA applications with reactivity to human samples 32857-1-AP targets APOBEC1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, L02 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Apolipoprotein B mRNA-editing enzyme catalytic subunit 1 (APOBEC1) is a member of the cytidine deaminase enzyme family. It forms a multiple-protein editing holoenzyme with APOBEC1 complementation factor (ACF) and APOBEC1 stimulating protein (ASP) (PMID: 30844405). This holoenzyme is involved in the editing of C-to-U nucleotide bases in apolipoprotein B and neurofibromatosis-1 mRNAs (PMID: 24916387; 11727199). APOBEC1 plays a crucial role in RNA editing, which is essential for the proper function of these proteins. Additionally, APOBEC1 has been implicated in various cellular processes, including the regulation of gene expression and the maintenance of genomic stability (PMID: 33094286). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26715 Product name: Recombinant human APOBEC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-135 aa of NM_001304566 Sequence: MTSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIWRSSGKNTTNHVEVNFIKKFTSERDFHPSMSCSITWFLSWSPCWECSQAIREFLSRHPGVTLVIYVARLFWHMDQQNRQGLRDLV Predict reactive species Full Name: apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1 Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: NM_001304566 Gene Symbol: APOBEC1 Gene ID (NCBI): 339 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P41238 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924