Proteintech, 32860-1-AP, SELENOO Polyclonal antibody

Size: 20ul / 150ul The SELENOO (32860-1-AP) by Proteintech is a Polyclonal antibody targeting SELENOO in WB, ELISA applications with reactivity to human samples 32860-1-AP targets SELENOO in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HEK-293 cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Background Information SELENOO (Selenoprotein O) is a selenocysteine-containing (Sec) selenoprotein belonging to the oxidoreductase family, which is mainly localized in the endoplasmic reticulum (ER) membranes with multiple transmembrane structural domains. SELENOO plays important roles in a variety of cellular processes, including redox homeostasis and lipid metabolism and DNA damage repair. It plays an important role in a variety of cellular processes, including redox homeostasis, lipid metabolism, and DNA damage repair. SELENOO is aberrantly expressed in a variety of diseases, including cancer and neurodegenerative diseases. For example, in melanoma and lung cancer, the upregulation of SELENOO expression is associated with tumor progression and metastasis, which has become a hot topic in current research. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35939 Product name: Recombinant human RP3-402G11.5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 477-666 aa of BC110866 Sequence: LARLMEQCASLEELRLAFRPQMDPRQLSMMLMLAQSNPQLFALMGTRAGIARELERVEQQSRLEQLSAAELQSRNQGHWADWLQAYRARLDKDLEGAGDAAAWQAEHVRVMHANNPKYVLRNYIAQNAIEAAERGDFSEVRRVLKLLETPYHCEAGAATDAEATEADGADGRQRSYSSKPPLWAAELCVT Predict reactive species Full Name: selenoprotein O Observed Molecular Weight: 70 kDa GenBank Accession Number: BC110866 Gene Symbol: RP3-402G11.5 Gene ID (NCBI): 83642 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9BVL4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.