Iright
BRAND / VENDOR: Proteintech

Proteintech, 32882-1-AP, FAM76B Polyclonal antibody

CATALOG NUMBER: 32882-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FAM76B (32882-1-AP) by Proteintech is a Polyclonal antibody targeting FAM76B in WB, ELISA applications with reactivity to human, mouse samples 32882-1-AP targets FAM76B in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: J774A.1 cells, SH-SY5Y cells, SK-N-SH cells, U-937 cells, RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information FAM76B is a nuclear protein with a molecular weight of about 39 kDa. Its amino acid sequence is highly conserved, and it is highly similar to FAM76B sequence of rats, mice and zebrafish. The protein contains histidine repeat sequence (poly-His domain) and ubiquitination site of Lys-225. FAM76B inhibits the inflammatory reaction mediated by NF-κB by affecting the cytoplasmic translocation of hnRNPA2B1. The expression of inflammatory factors (such as IL-6) increased significantly in FAM76B gene knockout mice, indicating that FAM76B has anti-inflammatory effect. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36658 Product name: Recombinant human FAM76B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 179-277 aa of NM_144664.4 Sequence: HHRHSSSHHKISNLSPEEEQGLWKQSHKSSATIQNETPKKKPKLESKPSNGDSSSINQSADSGGTDNFVLISQLKEEVMSLKRLLQQRDQTILEKDKKL Predict reactive species Full Name: family with sequence similarity 76, member B Calculated Molecular Weight: 39kDa,339aa Observed Molecular Weight: 36-39 kDa GenBank Accession Number: NM_144664.4 Gene Symbol: FAM76B Gene ID (NCBI): 143684 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q5HYJ3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924