Proteintech, 32901-1-AP, FAM173A Polyclonal antibody

Size: 20ul / 150ul The FAM173A (32901-1-AP) by Proteintech is a Polyclonal antibody targeting FAM173A in IHC, ELISA applications with reactivity to human, mouse samples 32901-1-AP targets FAM173A in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37690 Product name: Recombinant human FAM173A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 43-235 aa of BC001181 Sequence: QPGFRRVPLRLQVPYVGASARQVEHVLSLLRGRPGKTVDLGSGDGRIVLAAHRCGLRPAVGYELNPWLVALARLHAWRAGCAGSVCYRRKDLWKVSLRDCRNVSVFLAPSVLPLLEDKLRTELPAGARVVSGRFPLPTWQPVTAVGEGLDRVWAYDVPEGGQAGEAASSRIPIQAAPGPSSAPIPGGLISQAS Predict reactive species Full Name: family with sequence similarity 173, member A Calculated Molecular Weight: 235 aa, 25 kDa GenBank Accession Number: BC001181 Gene Symbol: FAM173A Gene ID (NCBI): 65990 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9BQD7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.