Proteintech, 32914-1-AP, SFT2D2 Polyclonal antibody

Size: 20ul / 150ul The SFT2D2 (32914-1-AP) by Proteintech is a Polyclonal antibody targeting SFT2D2 in WB, ELISA applications with reactivity to human samples 32914-1-AP targets SFT2D2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, Calu-1 cells, HeLa cells, MCF-7 cells Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information SFT2D2 is part of the SFT2 protein family, which is involved in managing membrane traffic inside cells. Its specific molecular role is linked to the Golgi apparatus, a central hub for processing and sorting proteins. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36996 Product name: Recombinant human SFT2D2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-63 aa of BC068098 Sequence: MDKLKKVLSGQDTEDRSGLSEVVEASSLSWSTRIKGFIACFAIGILCSLLGTVLLWVPRKGLH Predict reactive species Full Name: SFT2 domain containing 2 Calculated Molecular Weight: 160 aa, 18 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC068098 Gene Symbol: SFT2D2 Gene ID (NCBI): 375035 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O95562 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.