Iright
BRAND / VENDOR: Proteintech

Proteintech, 32924-1-AP, RBM18 Polyclonal antibody

CATALOG NUMBER: 32924-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RBM18 (32924-1-AP) by Proteintech is a Polyclonal antibody targeting RBM18 in WB, ELISA applications with reactivity to human samples 32924-1-AP targets RBM18 in applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information RBM18 (RNA Binding Motif Protein 18) functions as an RNA-binding protein and plays roles in various biological processes, including mRNA processing, cell cycle regulation, and ribosome assembly. Additionally, RBM18 is involved in transcriptional regulation and signal transduction. In cancer research, the expression levels of RBM18 are associated with the invasive and metastatic capabilities of tumors. For instance, RBM18 may act as a tumor suppressor in certain types of cancer by regulating the expression of specific genes to inhibit tumor cell proliferation. Therefore, RBM18 is considered a potential tumor suppressor. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38618 Product name: Recombinant human RBM18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-190 aa of NM_033117.3 Sequence: MEAETKTLPLENASILSEGSLQEGHRLWIGNLDPKITEYHLLKLLQKFGKVKQFDFLFHKSGALEGQPRGYCFVNFETKQEAEQAIQCLNGKLALSKKLVVRWAHAQVKRYDHNKNDKILPISLEPSSSTEPTQSNLSVTAKIKAIEAKLKMMAENPDAEYPAAPVYSYFKPPDKKRTTPYSRTAWKSRR* Predict reactive species Full Name: RNA binding motif protein 18 Calculated Molecular Weight: 22kDa,190aa Observed Molecular Weight: 22 kDa GenBank Accession Number: NM_033117.3 Gene Symbol: RBM18 Gene ID (NCBI): 92400 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96H35 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924