Proteintech, 32925-1-AP, TFAM Polyclonal antibody

Size: 20ul / 150ul The TFAM (32925-1-AP) by Proteintech is a Polyclonal antibody targeting TFAM in WB, ELISA applications with reactivity to mouse samples 32925-1-AP targets TFAM in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells, Neuro-2a cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information TFAM, also named as TCF6L2, MtTF1, TCF6, TCF6L1, TCF6L3 and mtTFA, is a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. It is involved in mitochondrial transcription regulation. TFAM is required for accurate and efficient promoter recognition by the mitochondrial RNA polymerase. It activates transcription by binding immediately upstream of transcriptional start sites. TFAM is able to unwind and bend DNA. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38622 Product name: Recombinant mouse Tfam protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 43-243 aa of BC083084 Sequence: SSMGSYPKKPMSSYLRFSTEQLPKFKAKHPDAKLSELVRKIAALWRELPEAEKKVYEADFKAEWKAYKEAVSKYKEQLTPSQLMGMEKEARQRRLKKKALVKRRELILLGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYIQLAKDDRIRYDNEMKSWEEQMAEVGRSDLIRRSVKRSGDISEH Predict reactive species Full Name: transcription factor A, mitochondrial Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC083084 Gene Symbol: Tfam Gene ID (NCBI): 21780 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P40630 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.