Proteintech, 32930-1-AP, CD2BP2 Polyclonal antibody

Size: 20ul / 150ul The CD2BP2 (32930-1-AP) by Proteintech is a Polyclonal antibody targeting CD2BP2 in WB, ELISA applications with reactivity to human samples 32930-1-AP targets CD2BP2 in applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information CD2BP2 (CD2-binding protein 2) is a multifunctional protein that was initially identified as a binding partner of the T-cell surface antigen CD2. It binds to the cytoplasmic tail of CD2 through its C-terminal GYF domain in the cytoplasm, regulating CD2-mediated T-lymphocyte activation. Additionally, CD2BP2 is a component of the U5 small nuclear ribonucleoprotein complex (snRNP), participating in the RNA splicing process. Studies have shown that CD2BP2 plays a crucial role in embryonic development; its absence leads to delayed embryonic growth, vascularization defects, and death by embryonic day 10.5. Specific depletion of CD2BP2 in renal podocytes results in proteinuria and ultimately fatal renal failure. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38662 Product name: Recombinant human CD2BP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 250-341 aa of NM_001243646.1 Sequence: MFAEELAEEELETPTPTQRGEAESRGDGLVDVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT* Predict reactive species Full Name: CD2 (cytoplasmic tail) binding protein 2 Calculated Molecular Weight: 38kDa，341aa Observed Molecular Weight: 50 kDa GenBank Accession Number: NM_001243646.1 Gene Symbol: CD2BP2 Gene ID (NCBI): 10421 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O95400 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.