Proteintech, 32965-1-AP, ADAMTSL5 Polyclonal antibody

Size: 20ul / 150ul The ADAMTSL5 (32965-1-AP) by Proteintech is a Polyclonal antibody targeting ADAMTSL5 in WB, ELISA applications with reactivity to human, mouse samples 32965-1-AP targets ADAMTSL5 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: COLO 320 cells, Caco-2 cells, HeLa cells, mouse skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37537 Product name: Recombinant human ADAMTSL5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 370-481 aa of NM_213604 Sequence: AHRLLHYCGSDFVFQARVLGHHHQAQETRYEVRIQLVYKNRSPLRAREYVWAPGHCPCPMLAPHRDYLMAVQRLVSPDGTQDQLLLPHAGYARPWSPAEDSRIRLTARRCPG Predict reactive species Full Name: ADAMTS-like 5 Calculated Molecular Weight: 53 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: NM_213604 Gene Symbol: ADAMTSL5 Gene ID (NCBI): 339366 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q6ZMM2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.