Iright
BRAND / VENDOR: Proteintech

Proteintech, 32969-1-AP, ADAM23 Polyclonal antibody

CATALOG NUMBER: 32969-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ADAM23 (32969-1-AP) by Proteintech is a Polyclonal antibody targeting ADAM23 in WB, ELISA applications with reactivity to human, mouse, rat samples 32969-1-AP targets ADAM23 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue, rat cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information ADAM23 (A disintegrin and metalloprotease protein 23), also known as MDC-3 (Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3) is a transmembrane type I glycoprotein involved with the development and maintenance of the nervous system, including neurite outgrowth, neuronal adhesion and differentiation and regulation of synaptic transmission. In addition, ADAM23 seems to participate in immune response and tumor establishment through interaction with different members of integrin receptors (PMID: 19692335). Two forms of ADAM23 have been previously described in primary cerebellar granule cells as an unprocessed precursor (100 kDa) and mature (70 kDa) protein, respectively (PMID: 29792904). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35744 Product name: Recombinant human ADAM23 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 342-488 aa of BC132765 Sequence: NTRVVLVAVETWTEKDQIDITTNPVQMLHEFSKYRQRIKQHADAVHLISRVTFHYKRSSLSYFGGVCSRTRGVGVNEYGLPMAVAQVLSQSLAQNLGIQWEPSSRKPKCDCTESWGGCIMEETGVSHSRKFSKCSILEYRDFLQRGG Predict reactive species Full Name: ADAM metallopeptidase domain 23 Calculated Molecular Weight: 832 aa, 92 kDa Observed Molecular Weight: 92 kDa, 70 kDa GenBank Accession Number: BC132765 Gene Symbol: ADAM23 Gene ID (NCBI): 8745 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O75077 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924