Proteintech, 32983-1-AP, GBGT1 Polyclonal antibody

Size: 20ul / 150ul The GBGT1 (32983-1-AP) by Proteintech is a Polyclonal antibody targeting GBGT1 in WB, ELISA applications with reactivity to human, mouse, rat samples 32983-1-AP targets GBGT1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, OVCAR-3 cells, SKOV-3 cells, mouse ovary tissue, rat ovary tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information GBGT1 (Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1) gene is located on chromosome 9 (9q34) and comprises 347 amino acids. GBGT1 is the most differentially expressed glycogene involved in the biosynthesis of Fs antigen and GBGT1 is differentially methylated and associated with inflammatory bowel disease (PMID: 25294702). GBGT1 mRNA expression has been observed in a variety of human tissues being highest in placenta and ovary (PMID: 31933576). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38506 Product name: Recombinant human GBGT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 185-347 aa of NM_021996.5 Sequence: ETISQHIAKRAHREVDYLFCLDVDMVFRNPWGPETLGDLVAAIHPSYYAVPRQQFPYERRRVSTAFVADSEGDFYYGGAVFGGQVARVYEFTRGCHMAILADKANGIMAAWREESHLNRHFISNKPSKVLSPEYLWDDRKPQPPSLKLIRFSTLDKDISCLRS Predict reactive species Full Name: globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 Calculated Molecular Weight: 40kDa，347aa Observed Molecular Weight: 40 kDa GenBank Accession Number: NM_021996.5 Gene Symbol: GBGT1 Gene ID (NCBI): 26301 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8N5D6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.