Iright
BRAND / VENDOR: Proteintech

Proteintech, 33010-1-AP, CD158K/KIR3DL2 Polyclonal antibody

CATALOG NUMBER: 33010-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD158K/KIR3DL2 (33010-1-AP) by Proteintech is a Polyclonal antibody targeting CD158K/KIR3DL2 in WB, ELISA applications with reactivity to human, mouse samples 33010-1-AP targets CD158K/KIR3DL2 in applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NK-92 cells, mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information KIR3DL2, also known as CD158k, is an inhibitory receptor expressed by natural killer (NK) cells and a subset of CD8+ T cells. It plays a role in immune regulation by binding to HLA class I molecules, specifically HLA-A3 and HLA-A11, in a peptide-dependent fashion. KIR3DL2 can also function as an innate immune receptor for delivering CpG DNA to TLR9 in NK cells, highlighting its role in both adaptive and innate immunity. This protein is primarily expressed on the cell surface, particularly in NK cells and certain T cells. It has been implicated in various diseases, particularly in the context of hematological malignancies and autoimmune diseases. Aberrant expression of KIR3DL2 has been observed in neoplastic cells in transformed mycosis fungoides and Sézary syndrome, suggesting its potential as a therapeutic target in primary cutaneous anaplastic large-cell lymphoma (pcALCL). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg4355 Product name: recombinant human CD158K/KIR3DL2 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 22-340 aa of NM_006737.4 Sequence: LMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHLH Predict reactive species Full Name: killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 2 Calculated Molecular Weight: 50 kDa Observed Molecular Weight: 50-60 kda GenBank Accession Number: NM_006737.4 Gene Symbol: KIR3DL2 Gene ID (NCBI): 3812 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P43630-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924