Proteintech, 33046-1-AP, NME1+NME2 Polyclonal antibody

Size: 20ul / 150ul The NME1+NME2 (33046-1-AP) by Proteintech is a Polyclonal antibody targeting NME1+NME2 in WB, ELISA applications with reactivity to human samples 33046-1-AP targets NME1+NME2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HEK-293T cells, HT-1080 cells, HeLa cells, HepG2 cells, MCF-7 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information NME1 and NME2 are associated with metastatic tumor suppression. NME1 and NME2 are multispecificity kinases phosphorylating serine, threonine, histidine, and aspartic acid residues of substrate proteins (PMID: 39032654). NME1 can catalyze the transfer of the terminal phosphate group of nucleoside triphosphates to nucleoside diphosphates to generate nucleoside triphosphates, which is crucial for DNA synthesis and repair. It also participates in cell signal transduction, proliferation, differentiation, and apoptosis. Reduced expression of NME1 is associated with increased tumor metastasis. For instance, in breast cancer, gastric cancer, and other malignancies, restoring NME1 expression can inhibit tumor invasion and metastasis. Similar to NME1, NME2 possesses nucleoside diphosphate kinase activity, participating in nucleotide metabolism and cell signaling regulation. It can form hexameric complexes with NME1 and also exists as homohexamers. Its functions overlap with those of NME1 to some extent but also exhibit unique roles in certain physiological processes. NME2 is involved in tumor metastasis regulation. However, its expression changes and specific mechanisms in different cancers may vary. In some tumors, NME2 expression is downregulated, while in others, it may be upregulated. For example, in hepatocellular carcinoma, reduced NME2 expression is associated with tumor progression and poor prognosis, whereas in ovarian cancer, elevated NME2 expression may promote tumor cell proliferation and metastasis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37892 Product name: Recombinant human NME1-NME2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-140 aa of BC107894 Sequence: MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRT Predict reactive species Full Name: NME1-NME2 readthrough transcript Calculated Molecular Weight: 17 kDa / 20 kDa Observed Molecular Weight: 17 kDa, 20 kDa GenBank Accession Number: BC107894 Gene Symbol: NME1-NME2 Gene ID (NCBI): 654364 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P22392 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.