Iright
BRAND / VENDOR: Proteintech

Proteintech, 33098-1-AP, Apcdd1 Polyclonal antibody

CATALOG NUMBER: 33098-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Apcdd1 (33098-1-AP) by Proteintech is a Polyclonal antibody targeting Apcdd1 in WB, IP, ELISA applications with reactivity to mouse, rat samples 33098-1-AP targets Apcdd1 in WB, IP, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse skin tissue, rat skin tissue Positive IP detected in: mouse skin tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information APCDD1 encodes a membrane-associated Wnt inhibitor that modulates β-catenin signaling during epithelial, vascular, and neural development. Anchored by a GPI linkage, APCDD1 binds Wnt components at the cell surface to restrict pathway activation and maintain tissue polarity. Dysregulation or mutation of APCDD1 contributes to hereditary hair loss, tumor progression, and vascular defects, underscoring its importance as a fine-tuner of Wnt-driven morphogenesis and homeostasis. (PMID: 32320685) Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg2690 Product name: Recombinant Mouse APCDD1 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 27-492 aa of NM_133237.3 Sequence: LLHPDSRSHPRSLEKSAWRAFKESQCHHMLKHLHNGARITVQMPPTIEGHWVSTGCEVRSGPEFMTRSYRFYNNNTFKAYQFYYGSNRCTNPTYTLIIRGKIRLRQASWIIRGGTEADYQLHGVQVICHTEAVAEQLSRLVNRTCPGFLAPGGPWVQDVAYDLWQEESNHECTKAVNFAMHELQLIRVEKQYPHHSLDHLVEELFLGDIHTDATQRVFYRPSSYQPPLQNAKNHNHACIACRIIFRSDEHHPPILPPKADLTIGLHGEWVSQRCEVRPEVLFLTRHFIFHDNNNTWEGHYYHYSDPVCKHPTFTIYARGRYSRGVLSSKVMGGTEFVFKVNHMKVTPMDAATASLLNVFSGNECGAEGSWQVGIQQDVTHTNGCVALGIKLPHTEYEIFKMEQDTRGRYLLFNGQRPSDGSSPDRPEKRATSYQMPLVQCASSSPRAEELLEDSQGHLYGRAAGRT Predict reactive species Full Name: adenomatosis polyposis coli down-regulated 1 Calculated Molecular Weight: 59 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: NM_133237.3 Gene Symbol: Apcdd1 Gene ID (NCBI): 494504 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q3U128 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924