Proteintech, 33108-1-AP, SLC26A9 Polyclonal antibody

Size: 20ul / 150ul The SLC26A9 (33108-1-AP) by Proteintech is a Polyclonal antibody targeting SLC26A9 in WB, IP, ELISA applications with reactivity to human, mouse samples 33108-1-AP targets SLC26A9 in WB, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse stomach tissue Positive IP detected in: BxPC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Solute carrier family 26 member 9 (SLC26A9) is one out of 11 proteins that belong to the SLC26A family of anion transporters. Apart from expression in the gastrointestinal tract, SLC26A9 is also found in the respiratory system, in male tissues and in the skin. SLC26A9 has gained attention because of its modifier role in the gastrointestinal manifestation of cystic fibrosis (CF). SLC26A9 appears to have an impact on the extent of intestinal obstruction caused by meconium ileus. SLC26A9 supports duodenal bicarbonate secretion, but was assumed to provide a basal Cl- secretory pathway in airways. (PMID: 36866602). SLC26A9 was shown to be located at the luminal side of lung bronchiolar and alveolar epithelium (PMID: 11834742). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37313 Product name: Recombinant human SLC26A9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-70 aa of BC151208 Sequence: MSQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPVGEKLRNAFRCSSAKIKAVVFGLLPVLSWLPNYKIKDY Predict reactive species Full Name: solute carrier family 26, member 9 Calculated Molecular Weight: 791 aa, 87 kDa Observed Molecular Weight: 100-115 kDa GenBank Accession Number: BC151208 Gene Symbol: SLC26A9 Gene ID (NCBI): 115019 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q7LBE3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.