Proteintech, 33118-1-AP, XAGE2 Polyclonal antibody

Size: 20ul / 150ul The XAGE2 (33118-1-AP) by Proteintech is a Polyclonal antibody targeting XAGE2 in WB, IF/ICC, ELISA applications with reactivity to human samples 33118-1-AP targets XAGE2 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Caco-2 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information XAGE2 (member 2 of the X antigen family), also known as CT12.2, GAGED3, XAGE-2, and XAGE2B, is a cancer-testis (CT) antigen that belongs to the GAGE family. This protein is strongly expressed in normal testes and is abnormally expressed in various tumors, including Ewing's sarcoma, rhabdomyosarcoma, breast cancer, and germ cell tumors. The XAGE2 protein shares sequence similarity with other GAGE/PAGE proteins, and its expression pattern and sequence similarity make it a member of the CT antigen family. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35814 Product name: Recombinant human XAGE2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 17-111 aa of NM_130777 Sequence: LQPPELIGAMLEPTDEEPKEEKPPTKSRNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV Predict reactive species Full Name: X antigen family, member 2 Calculated Molecular Weight: 12kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: NM_130777 Gene Symbol: XAGE2 Gene ID (NCBI): 9502 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96GT9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.