Iright
BRAND / VENDOR: Proteintech

Proteintech, 33141-1-AP, CFAP161 Polyclonal antibody

CATALOG NUMBER: 33141-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CFAP161 (33141-1-AP) by Proteintech is a Polyclonal antibody targeting CFAP161 in WB, ELISA applications with reactivity to human, mouse, rat samples 33141-1-AP targets CFAP161 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human testis tissue, mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Cilia- and flagella-associated protein 161 (CFAP161) is a protein involved in the formation and function of motile cilia. It is a target gene of the transcription factor FOXJ1, which controls the expression of numerous ciliary components. CFAP161 is highly conserved across species and is essential for the proper function of motile cilia, which are critical for various physiological processes, including mucociliary clearance and sperm motility (PMID: 34172766; 39215164). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37789 Product name: Recombinant human CFAP161 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-193 aa of NM_173528 Sequence: MKDFLEKRDKGKLLIQRSRRLKQNLLRPMQLSVTEDGYIHYGDKVMLVNPDDPDTEADVFLRGDLSLCMTPDEIQSHLKDELEVPCGLSAVQAKTPIGRNTFIILSVHRDATGQVLRYGQDFCLGITGGFDNKMLYLSSDHRTLLKSSKRSWLQEVYLTDEVSHVNCW Predict reactive species Full Name: chromosome 15 open reading frame 26 Calculated Molecular Weight: 301aa, 34 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: NM_173528 Gene Symbol: C15orf26 Gene ID (NCBI): 161502 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q6P656 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924