Proteintech, 33151-1-AP, INSM2 Polyclonal antibody

Size: 20ul / 150ul The INSM2 (33151-1-AP) by Proteintech is a Polyclonal antibody targeting INSM2 in WB, ELISA applications with reactivity to human samples 33151-1-AP targets INSM2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, Calu-1 cells, SH-SY5Y cells, SK-N-SH cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information INSM2 (Insulinoma-associated protein 2) is a zinc-finger protein belonging to the transcription factor family and has transcriptional repressive functions. It may exert growth-inhibitory or tumor-suppressive effects in hepatocytes and certain neurons. The primary function of INSM2 involves the regulation of gene expression, particularly the repression of insulin gene expression in non-pancreatic cells. Additionally, INSM2 is upregulated in neuroblastoma and is associated with poor prognosis. It promotes tumor development by affecting lipid metabolism through the regulation of the mTOR signaling pathway. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38945 Product name: Recombinant human INSM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-210 aa of NM_032594.3 Sequence: MPRGFLVKRTKRTGGLYRVRLAERVFPLLGPQGAPPFLEEAPSASLPGAERATPPTREEPGKGLTAEAAREQSGSPCRAAGVSPGTGGREGAEWRAGGREGPGPSPSPSPSPAKPAGAELRRAFLERCLSSPVSAESFPGGAAAVAAFSCSVAPAAAPTPGEQFLLPLRAPFPEPALQPDPAPLSAALQSLKRAAGGERRGKAPTDCASG Predict reactive species Full Name: insulinoma-associated 2 Calculated Molecular Weight: 59kDa，566aa Observed Molecular Weight: 68 kDa GenBank Accession Number: NM_032594.3 Gene Symbol: INSM2 Gene ID (NCBI): 84684 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96T92 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.