Iright
BRAND / VENDOR: Proteintech

Proteintech, 33214-1-AP, CD6 Polyclonal antibody

CATALOG NUMBER: 33214-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD6 (33214-1-AP) by Proteintech is a Polyclonal antibody targeting CD6 in WB, IHC, ELISA applications with reactivity to human samples 33214-1-AP targets CD6 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HuT 78 cells, human PBMCs Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information CD6 is a type I transmembrane glycoprotein that belongs to the scavenger receptor cysteine-rich superfamily (PMID: 21880988). It is composed of an extracellular region, which consists of three tandem SRCR domains, a transmembrane region, and a cytoplasmic tail devoid of intrinsic catalytic activity but harboring several phosphorylatable residues suitable for intracellular signal transduction (PMID: 38139340; 23711376). CD6 is expressed by T cells, medullary thymocytes, a subset of B cells and NK cells, and in some cells of the brain (PMID: 1919444; 21178331). CD6 plays a role in lymphocyte activation, proliferation, and survival processes via interaction with its endogenous ligands. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag40035 Product name: Recombinant human CD6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 429-665 aa of BC078669 Sequence: KYALPVMVNHQHLPTTIPAGSNSYQPVPITIPKEVFMLPIQVQAPPPEDSDSGSDSDYEHYDFSAQPPVALTTFYNSQRHRVTDEEVQQSRFQMPPLEEGLEELHASHIPTANPGHCITDPPSLGPQYHPRSNSESSTSSGEDYCNSPKSKLPPWNPQVFSSERSSFLEQPPNLELASTQPAFSAGPPADDSSSTSSGEWYQNFQPPPQPPSEEQFGCPGSPSPQPDSTDNDDYDDI Predict reactive species Full Name: CD6 molecule Calculated Molecular Weight: 668 aa, 72 kDa Observed Molecular Weight: 120-130 kDa GenBank Accession Number: BC078669 Gene Symbol: CD6 Gene ID (NCBI): 923 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P30203 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924