Proteintech, 33231-1-AP, CDY1B Polyclonal antibody

Size: 20ul / 150ul The CDY1B (33231-1-AP) by Proteintech is a Polyclonal antibody targeting CDY1B in WB, ELISA applications with reactivity to human samples 33231-1-AP targets CDY1B in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information The CDY1B gene, also known as Chromodomain Y-Linked 1B, is a Protein Coding gene located on the Y chromosome. It is one of the two identical copies of the CDY1 gene within the AZFc region of the human Y chromosome. As a histone acetyltransferase, CDY1B exhibits a strong preference for histone 4, suggesting its involvement in both spermatogenic histone replacement and DNA transcription. It plays a significant role in the chromatin remodeling of round spermatid nuclei, contributing to the transition from histone-based chromatin to protamine-based chromatin during spermatogenesis. This transition is essential for the condensation of sperm DNA and the formation of mature sperm. Deletion of either CDY1 can lead to spermatogenic failure and male infertility. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37962 Product name: Recombinant human CDY1B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 65-300 aa of BC132929 Sequence: LTWTTTSRIFSNNARRRTSRSTKANYSKNSPKTPVTDKHHRSKNRKLFAASKNVRRKAASILSDTKNMEIINSTIETLAPDSPFDHKTVSGFQKLEKLDPIAADQQDTVVFKVTEGKLLRDPLSRPGAEQTGIQNKTQIHPLMSQMSGSVTASMATGSATRKGIVVLIDPLAANGTTDMHTSVPRVKGGQRNITDDSRDQPFIKKMHFTIRLTESASTYRDIVVKKEDGFTQIVLS Predict reactive species Full Name: chromodomain protein, Y-linked, 1B Calculated Molecular Weight: 540 aa, 60 kDa/554 aa, 62 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC132929 Gene Symbol: CDY1B Gene ID (NCBI): 253175 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9Y6F8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.