Proteintech, 33236-1-AP, DEFB119 Polyclonal antibody

Size: 20ul / 150ul The DEFB119 (33236-1-AP) by Proteintech is a Polyclonal antibody targeting DEFB119 in WB, ELISA applications with reactivity to human samples 33236-1-AP targets DEFB119 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information DEFB119 is a reproductive tract-specific β-defensin highly expressed in the testis and the epididymis (16). Single-cell sequencing analysis of testicular cells isolated from nonobstructive azoospermia men demonstrates an elevated expression of DEFB119 in the Sertoli cells. Male mice lacking the mouse ortholog DEFB19 demonstrated subfertility in both sexes. DEFB119 is also expressed in sperm and is involved in sperm chemotaxis. Elevated seminal DEFB119 was associated with a decrease in the observed genera, diversity and evenness of bacterial communities, and further distortion of the metacommunities (PMID: 39359400). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36816 Product name: Recombinant human DEFB119 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 22-84 aa of BC062212 Sequence: KRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSYMRISISGKEENTDWSYEKQWPRLP Predict reactive species Full Name: defensin, beta 119 Calculated Molecular Weight: 84 aa, 10 kDa Observed Molecular Weight: 10 kDa GenBank Accession Number: BC062212 Gene Symbol: DEFB119 Gene ID (NCBI): 245932 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8N690 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.