Proteintech, 33254-1-AP, NDRG4 Polyclonal antibody

Size: 20ul / 150ul The NDRG4 (33254-1-AP) by Proteintech is a Polyclonal antibody targeting NDRG4 in WB, ELISA applications with reactivity to human, mouse, rat samples 33254-1-AP targets NDRG4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse cerebellum tissue, rat brain tissue, rat cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information NDRG4 (N-myc downstream-regulated gene 4) is a member of the NDRG family (NDRG1-4), a group of evolutionarily conserved proteins implicated in cell differentiation, stress responses, and tumor suppression. Unlike other family members (e.g., NDRG1 linked to cancer metastasis), NDRG4 is highly expressed in the brain and heart, with emerging roles in neuronal development and cardiovascular function. Methylation of NDRG4 in stool DNA is a diagnostic marker for colorectal cancer. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38351 Product name: Recombinant human NDRG4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 42-223 aa of BC011795 Sequence: NHKLCFNTFFNFEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQFPSMEQLAAMLPSVVQHFGFKYVIGIGVGAGAYVLAKFALIFPDLVEGLVLVNIDPNGKGWIDWAATKLSGLTSTLPDTVLSHLFSQEELVNNTELVQSYRQQIGNVVNQANLQLFWNMYNSRRDLDINRPGTVPNAK Predict reactive species Full Name: NDRG family member 4 Calculated Molecular Weight: 339 aa, 37 kDa Observed Molecular Weight: 37 kDa, 38 kDa and 41 kDa GenBank Accession Number: BC011795 Gene Symbol: NDRG4 Gene ID (NCBI): 65009 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9ULP0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.