Proteintech, 33280-1-AP, NOTCH4 Polyclonal antibody

Size: 20ul / 150ul The NOTCH4 (33280-1-AP) by Proteintech is a Polyclonal antibody targeting NOTCH4 in WB, IHC, ELISA applications with reactivity to human, mouse samples 33280-1-AP targets NOTCH4 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells Positive IHC detected in: mouse lung tissue, mouse heart tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Neurogenic locus notch homolog protein 4 (NOTCH4) is a receptor involved in the Notch signaling pathway, which is synthesized as a precursor that undergoes proteolytic cleavage to form an active receptor. NOTCH4 interacts with various ligands, leading to the release of the Notch intracellular domain (NICD), which translocates to the nucleus and regulates gene expression (PMID: 28794168; 19379690; 17148788). NOTCH4 is involved in various biological processes, including embryonic development, immune cell differentiation, and tumorigenesis (PMID: 24667410; 34925319). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36738 Product name: Recombinant human NOTCH4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 309-648 aa of BC140782 Sequence: DCSEDVDECETQGPPHCRNGGTCQNSAGSFHCVCVSGWGGTSCEENLDDCIAATCAPGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHGDAQCSTNPLTGSTLCLCQPGYSGPTCHQDLDECLMAQQGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLSQPCHPGSTCLDLLATFHCLCPPGLEGQLCEVETNECASAPCLNHADCHDLLNGFQCICLPGFSGTRCEEDIDECRSSPCANGGQCQDQPGAFHCKCLPGFEGPRCQTEVDECLSDPCPVGASCLDLPGAFFCLCPSGFTGQLCEVPLCAPNLCQPKQICKDQKDKANC Predict reactive species Full Name: Notch homolog 4 (Drosophila) Calculated Molecular Weight: 2003 aa, 210 kDa Observed Molecular Weight: 210 kDa GenBank Accession Number: BC140782 Gene Symbol: NOTCH4 Gene ID (NCBI): 4855 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q99466 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.