Proteintech, 33301-1-AP, IGLC6 Polyclonal antibody

Size: 20ul / 150ul The IGLC6 (33301-1-AP) by Proteintech is a Polyclonal antibody targeting IGLC6 in WB, ELISA applications with reactivity to human samples 33301-1-AP targets IGLC6 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma, human serum Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Human immunoglobulin lambda light chain (IGL) locus is localized on chromosome 22 and contains from seven to eleven immunoglobulin lambda light chain constant region (IGLC) genes, of which 4-5 are functional and each IGLC gene is preceded by its own IGLJ gene. Igλ was also proven to be expressed in other cancer cells, such as cervical cancer, hepatocellular cancer, breast cancer, pancreas cancer, prostate cancer, gastric cancer cells and colorectal cancer cells. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg4580 Product name: Recombinant Human IGLC6 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 1-106 aa of / Sequence: GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVKVAWKADGSPVNTGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPAECS Predict reactive species Full Name: immunoglobulin lambda constant 6 (Kern+Oz- marker, gene/pseudogene) Calculated Molecular Weight: 11 kDa Observed Molecular Weight: 22-25 kDa GenBank Accession Number: / Gene Symbol: IGLC6 Gene ID (NCBI): 3542 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P0CF74 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.