Iright
BRAND / VENDOR: Proteintech

Proteintech, 33316-1-AP, C9orf169 Polyclonal antibody

CATALOG NUMBER: 33316-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The C9orf169 (33316-1-AP) by Proteintech is a Polyclonal antibody targeting C9orf169 in WB, ELISA applications with reactivity to human samples 33316-1-AP targets C9orf169 in applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, MDA-MB-231 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information CYSRT1 is highly conserved among vertebrates and has putative antimicrobial activity. CYSRT1 colocalizes with LCE proteins and contributes to the constitutive epidermal antimicrobial host defense repertoire (PMID: 36804407). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37408 Product name: Recombinant human C9orf169 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-144 aa of BC052297 Sequence: MDPQEMVVKNPYAHISIPRAHLRPDLGQQLEVASTCSSSSEMQPLPVGPCAPEPTHLLQPTEVPGPKGAKGNQGAAPIQNQQAWQQPGNPYSSSQRQAGLTYAGPPPVGRGDDIAHHCCCCPCCHCCHCPPFCRCHSCCCCVIS Predict reactive species Full Name: chromosome 9 open reading frame 169 Calculated Molecular Weight: 144 aa, 15 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC052297 Gene Symbol: C9orf169 Gene ID (NCBI): 375791 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: A8MQ03 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924