Proteintech, 33320-1-AP, OPN1LW Polyclonal antibody

Size: 20ul / 150ul The OPN1LW (33320-1-AP) by Proteintech is a Polyclonal antibody targeting OPN1LW in IP, ELISA applications with reactivity to human, mouse, rat samples 33320-1-AP targets OPN1LW in IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IP detected in: mouse retina tissue, rat retina tissue Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37894 Product name: Recombinant human OPN1LW protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-52 aa of BC156643 Sequence: MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWV Predict reactive species Full Name: opsin 1 (cone pigments), long-wave-sensitive Observed Molecular Weight: 40 kDa GenBank Accession Number: BC156643 Gene Symbol: OPN1LW Gene ID (NCBI): 5956 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P04000 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.