Proteintech, 33419-1-AP, CD70 Polyclonal antibody

Size: 20ul / 150ul The CD70 (33419-1-AP) by Proteintech is a Polyclonal antibody targeting CD70 in WB, ELISA applications with reactivity to mouse, rat samples 33419-1-AP targets CD70 in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse thymus tissue, rat thymus tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information CD70, also known as tumor necrosis factor ligand superfamily member 7 (TNFSF7) or CD27 ligand (CD27L), is a transmembrane protein that plays a significant role in the immune system. It is the unique ligand for CD27, a member of the tumor necrosis factor receptor (TNFR) family, and is transiently upregulated upon stimulation of immune cells. CD70 is expressed on lymphocytes and dendritic cells, and its expression can be regulated by activation signals received via toll-like receptors (TLRs), CD40, and the antigen receptor MHC II. It provides complex and not completely understood signaling for B cell development. CD70 is also expressed on various solid tumors and hematolymphoid malignancies, where it may contribute to a poor prognosis. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg5287 Product name: recombinant rat CD70/CD27 Ligand protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 46-195 aa of NM_001106878.1 Sequence: QHVLLEPPELHVAELQLNLTDPQKDLTLRWGAGPALGRSFTHGPGLEKGNLRIHQDGIYRLHIQVTLANCSSSGSALQHRASLVVGICSPAVHIISLLRRRFGQDCTVSLQRLTPLARGDVLCSNLTQPLLPSRNADETFFGVQRVYPWP Predict reactive species Full Name: Cd70 molecule Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: NM_001106878.1 Gene Symbol: Cd70 Gene ID (NCBI): 301132 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: A6KQR5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.