Proteintech, 33432-1-AP, MPZL1 Polyclonal antibody

Size: 20ul / 150ul The MPZL1 (33432-1-AP) by Proteintech is a Polyclonal antibody targeting MPZL1 in WB, ELISA applications with reactivity to mouse, rat samples 33432-1-AP targets MPZL1 in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information MPZL1(myelin protein zero like 1, also known as PZR) is a transmembrane glycoprotein of immunoglobulin superfamily, whose core function is to mediate cell adhesion and signal transduction. By recruiting molecules such as SHP-2, it regulates Src, TGF-β and other pathways, and its abnormality is closely related to tumor metastasis, neurological diseases and so on. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg6820 Product name: Recombinant mouse MPZL1 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 36-162 aa of NM_001083897.1 Sequence: SALEVHTPKEIFVVNGTQGKLTCTFDSPNTTGWLTTVSWSFQPDGTDSAVSFFHYSQGQVYIGDYPPFKDRVTWAGDLDKKDASINIENIQAVHNGTYICDVKNPPDIVVRPGHIRLHVVEIDNLLV Predict reactive species Full Name: myelin protein zero-like 1 Calculated Molecular Weight: 29 kDa Observed Molecular Weight: 27-29 kDa GenBank Accession Number: NM_001083897.1 Gene Symbol: Mpzl1 Gene ID (NCBI): 68481 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q3TEW6-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.