Iright
BRAND / VENDOR: Proteintech

Proteintech, 33434-1-AP, HPR Polyclonal antibody

CATALOG NUMBER: 33434-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HPR (33434-1-AP) by Proteintech is a Polyclonal antibody targeting HPR in WB, ELISA applications with reactivity to human samples 33434-1-AP targets HPR in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Haptoglobin-related protein (Hpr) is a plasma protein with high sequence similarity to haptoglobin (Hp). Like Hp, Hpr also binds hemoglobin (Hb) with high affinity, but it does not bind to the Hb-Hp receptor CD163 on macrophages (PMID: 36129375). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg5219 Product name: Recombinant human HPR protein Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 20-348 aa of NM_020995.3 Sequence: LYSGNDVTDISDDRFPKPPEIANGYVEHLFRYQCKNYYRLRTEGDGVYTLNDKKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYHQVDIGLIKLKQKVLVNERVMPICLPSKNYAEVGRVGYVSGWGQSDNFKLTDHLKYVMLPVADQYDCITHYEGSTCPKWKAPKSPVGVQPILNEHTFCVGMSKYQEDTCYGDAGSAFAVHDLEEDTWYAAGILSFDKSCAVAEYGVYVKVTSIQHWVQKTIAEN Predict reactive species Full Name: haptoglobin-related protein Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: NM_020995.3 Gene Symbol: HPR Gene ID (NCBI): 3250 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P00739-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924