Proteintech, 33448-1-AP, ZNF85 Polyclonal antibody

Size: 20ul / 150ul The ZNF85 (33448-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF85 in WB, ELISA applications with reactivity to human, mouse, rat samples 33448-1-AP targets ZNF85 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HuH-7 cells, Daudi cells, Huh7 cells, SKOV-3 cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38326 Product name: Recombinant human ZNF85 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 60-200 aa of NM_003429.4 Sequence: KEAWSMKRHEIMVAKPTVMCSHFAQDLWPEQNIKDSFQKVTLKRYGKCRHENLPLRKGCESMDECKMHKGGCNGLNQCLTATQSKIFQCDKYVKVAHKFSNSNRHEIRHTKKKPFKCTKCGKSFGMISCLTEHSRIHTRVN Predict reactive species Full Name: zinc finger protein 85 Calculated Molecular Weight: 69kDa，595aa Observed Molecular Weight: 70 kDa GenBank Accession Number: NM_003429.4 Gene Symbol: ZNF85 Gene ID (NCBI): 7639 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q03923 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.