Proteintech, 33458-1-AP, MED7 Polyclonal antibody

Size: 20ul / 150ul The MED7 (33458-1-AP) by Proteintech is a Polyclonal antibody targeting MED7 in WB, ELISA applications with reactivity to human samples 33458-1-AP targets MED7 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, Calu-3 cells, Daudi cells, MG-63 cells, PC-3 cells, T-47D cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information MED7 is a crucial subunit of the Mediator complex, a protein complex that regulates gene transcription by interacting with RNA polymerase II. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38214 Product name: Recombinant human MED7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-233 aa of BC006968 Sequence: MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIEKDAALCVLIDEMNERP Predict reactive species Full Name: mediator complex subunit 7 Calculated Molecular Weight: 233 aa, 27 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC006968 Gene Symbol: MED7 Gene ID (NCBI): 9443 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O43513 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.