Proteintech, 33464-1-AP, IPCEF1 Polyclonal antibody

Size: 20ul / 150ul The IPCEF1 (33464-1-AP) by Proteintech is a Polyclonal antibody targeting IPCEF1 in WB, ELISA applications with reactivity to human samples 33464-1-AP targets IPCEF1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells, THP-1 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35423 Product name: Recombinant human IPCEF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 210-437 aa of BC143629 Sequence: FPSSLSKERQSLPDTVNSLSAAEDEGQPITFAVQVHSPVPSEAGIHKALENSFVTSESGFLNSLSSDDTSSLSSNHDHLTVPDKPAGSKIMDKEETKVSEDDEMEKLYKSLEQASLSPLGDRRPSTKKELRKSFVKRCKNPSINEKLHKIRTLNSTLKCKEHDLAMINQLLDDPKLTARKYREWKVMNTLLIQDIYQQQRASPAPDDTDDTPQELKKSPSSPSVENSI Predict reactive species Full Name: interaction protein for cytohesin exchange factors 1 Calculated Molecular Weight: 49 kDa Observed Molecular Weight: 49 kDa GenBank Accession Number: BC143629 Gene Symbol: IPCEF1 Gene ID (NCBI): 26034 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8WWN9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.