Proteintech, 33470-1-AP, GRK4 Polyclonal antibody

Size: 20ul / 150ul The GRK4 (33470-1-AP) by Proteintech is a Polyclonal antibody targeting GRK4 in WB, ELISA applications with reactivity to human, mouse samples 33470-1-AP targets GRK4 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: RAW 264.7 cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information G protein-coupled receptor kinase 4 (GRK4) is a serine and threonine kinase that phosphorylates G protein-coupled receptors in response to agonist stimulation. It uncouples the dopamine receptor from its G protein. It should also be noted that kinase activity is not necessary for some GRK-mediated functions. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38007 Product name: Recombinant human GRK4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 381-510 aa of NM_182982.2 Sequence: QGHSPFKKYKEKVKWEEVDQRIKNDTEEYSEKFSEDAKSICRMLLTKNPSKRLGCRGEGAAGVKQHPVFKDINFRRLEANMLEPPFCPDPHAVYCKDVLDIEQFSVVKGIYLDTADEDFYARFATGCVSI Predict reactive species Full Name: G protein-coupled receptor kinase 4 Calculated Molecular Weight: NM_182982.2 Observed Molecular Weight: 67 kDa GenBank Accession Number: NM_182982.2 Gene Symbol: GRK4 Gene ID (NCBI): 2868 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P32298 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.