Proteintech, 33480-1-AP, SMAD3 Polyclonal antibody

Size: 20ul / 150ul The SMAD3 (33480-1-AP) by Proteintech is a Polyclonal antibody targeting SMAD3 in WB, ELISA applications with reactivity to human samples 33480-1-AP targets SMAD3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U-87 MG cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information SMAD3, also named as hMAD 3 or Mad3, is a 425 amino acid protein, which contains one MH1 domain and one MH2 domain. SMAD3 localizes in the nucleus and cytoplasm. SMAD3 plays an essential role in development and maintenance of self-tolerance and is a critical mediator of the TGFB signaling pathway. SMAD3 is involved in TGFB dependent regulation of steroidogenesis and in T-cell response to TGFB. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8263 Product name: Recombinant human SMAD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-141 aa of BC007496 Sequence: MACTYVSNLGKKQRSVSFLASGLMRVSTGPELRLHHSFVLTGDVGRRICRLLVGLFTKGDTSSKRVHPFSPGPCFLLCDLARVGSSPKINVSPFYQNQTSTQRSCTVFVWQRCSLVGPFQVTVFTMYFHHSLRSISRFSSG Predict reactive species Full Name: SMAD family member 3 Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC007496 Gene Symbol: SMAD3 Gene ID (NCBI): 4088 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P84022 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.