Iright
BRAND / VENDOR: Proteintech

Proteintech, 33483-1-AP, WDSOF1 Polyclonal antibody

CATALOG NUMBER: 33483-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The WDSOF1 (33483-1-AP) by Proteintech is a Polyclonal antibody targeting WDSOF1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 33483-1-AP targets WDSOF1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: NIH/3T3 cells Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information WDSOF1 (WD repeat and SOF1 domain-containing 1, also known as DCAF13) functions as a substrate receptor subunit for the CRL4-DDB1 E3 ubiquitin ligase complex. It contains WD40 repeat clusters and is primarily localized in the nucleolus, where it participates in the processing of 40S ribosomal RNA precursors and the regulation of the estrogen receptor. Recent research has revealed its indispensable role in uterine development: its deficiency leads to the downregulation of estrogen target genes, an increase in H3K9me3 levels, failure of embryo implantation, and complete infertility in female mice. Furthermore, WDSOF1 is located at 8q22.3, a genomic region frequently amplified in tumors. It is highly expressed in various cancers, including liver and breast cancer, and is associated with poor prognosis, positioning it as an oncogenic factor and a potential therapeutic target. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35559 Product name: Recombinant human WDSOF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 249-597 aa of BC112042 Sequence: TQRNCIRTIQAHEGFVRGICTRFCGTSFFTVGDDKTVKQWKMDGPGYGDEEEPLHTILGKTVYTGIDHHWKEAVFATCGQQVDIWDEQRTNPICSMTWGFDSISSVKFNPIETFLLGSCASDRNIVLYDMRQATPLKKVILDMRTNTICWNPMEAFIFTAANEDYNLYTFDMRALDTPVMVHMDHVSAVLDVDYSPTGKEFVSASFDKSIRIFPVDKSRSREVYHTKRMQHVICVKWTSDSKYIMCGSDEMNIRLWKANASEKLGVLTSREKAAKDYNQKLKEKFQHYPHIKRIARHRHLPKSIYSQIQEQRIMKEARRRKEVNRIKHSKPGSVPLVSEKKKHVVAVVK Predict reactive species Full Name: WD repeats and SOF1 domain containing Calculated Molecular Weight: 597 aa, 67 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC112042 Gene Symbol: WDSOF1 Gene ID (NCBI): 25879 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9NV06 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924