Product Description
Size: 20ul / 150ul
The TMEM256 (33511-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM256 in WB, ELISA applications with reactivity to human samples
33511-1-AP targets TMEM256 in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: A549 cells, Calu-1 cells, LNCaP cells, U-251 cells, Y79 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Background Information
TMEM256, also known as C17orf61, is a number of TMEM families, encodes a protein of ~11.7 kDa, TMEM256 is expressed in proximal renal tubular cells, and its subcellular localization is in exosomes (PMID: 39991002).
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag36789 Product name: Recombinant human C17orf61 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-92 aa of BC030270 Sequence: AQFPDAYGKELFDKANKHHFLHSLALLGVPHCRKPLWAGLLLASGTTLFCTSFYYQALSGDPS Predict reactive species
Full Name: chromosome 17 open reading frame 61
Observed Molecular Weight: 12 kDa
GenBank Accession Number: BC030270
Gene Symbol: C17orf61
Gene ID (NCBI): 254863
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity Purification
UNIPROT ID: Q8N2U0
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924