Iright
BRAND / VENDOR: Proteintech

Proteintech, 33515-1-AP, SBF1 Polyclonal antibody

CATALOG NUMBER: 33515-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SBF1 (33515-1-AP) by Proteintech is a Polyclonal antibody targeting SBF1 in WB, ELISA applications with reactivity to human, mouse, rat samples 33515-1-AP targets SBF1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Raji cells, Ramos cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Background Information Sbf1, a pseudophosphatase of the myotubularin family, is expressed at high levels in seminiferous tubules of the testis, specifically in Sertoli's cells, spermatogonia, and pachytene spermatocytes, but not in postmeiotic round spermatids. Mice that are nullizygous for Sbf1 exhibit male infertility characterized by azoospermia. Faint bands in some lanes around 150 kDa represent apparent Sbf1 degradation products (PMID: 11994405). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38267 Product name: Recombinant human SBF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1300-1430 aa of CCDS93186.1 Sequence: AGRDALAPPQANGGPPDPGFLRPQRAALYILGDKAQLKGVRSDPLQQWELVPIEVFEARQVKASFKKLLKACVPGCPAAEPSPASFLRSLEDSEWLIQIHKLLQVSVLVVELLDSGSSVLVGLEDGWDITT Predict reactive species Full Name: SET binding factor 1 Calculated Molecular Weight: 208kDa,1868aa Observed Molecular Weight: 210 kDa, 140 kDa GenBank Accession Number: CCDS93186.1 Gene Symbol: SBF1 Gene ID (NCBI): 6305 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O95248 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924