Proteintech, 33577-1-AP, SEMA6A Polyclonal antibody

Size: 20ul / 150ul The SEMA6A (33577-1-AP) by Proteintech is a Polyclonal antibody targeting SEMA6A in WB, ELISA applications with reactivity to human samples 33577-1-AP targets SEMA6A in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Semaphorin 6A (SEMA6A) is a member of the semaphorin family. In humans it is encoded on chromosome 5 and is expressed most strongly in the developing and adult nervous system, but it is also present in heart, kidney, adrenal gland and placenta. SEMA6A overexpression alleviated CRC progression by inhibiting tumor growth and metastasis both in vivo and in vitro (PMID: 41259456). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag40550 Product name: Recombinant human SEMA6A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 400-649 aa of BC032619 Sequence: EAVPSIFNRPWFLRTMVRYRLTKIAVDTAAGPYQNHTVVFLGSEKGIILKFLARIGNSGFLNDSLFLEEMSVYNSEKCSYDGVEDKRIMGMQLDRASSSLYVAFSTCVIKVPLGRCERHGKCKKTCIASRDPYCGWIKEGGACSHLSPNSRLTFEQDIERGNTDGLGDCHNSFVALNGHSSSLLPSTTTSDSTAQEGYESRGGMLDWKHLLDSPDSTDPLGAVSSHNHQDKKGVIRESYLKGHDQLVPVT Predict reactive species Full Name: sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6A Calculated Molecular Weight: 1030 aa, 114 kDa Observed Molecular Weight: 114 kDa GenBank Accession Number: BC032619 Gene Symbol: SEMA6A Gene ID (NCBI): 57556 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9H2E6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.