Proteintech, 33580-1-AP, LANCL2 Polyclonal antibody

Size: 20ul / 150ul The LANCL2 (33580-1-AP) by Proteintech is a Polyclonal antibody targeting LANCL2 in WB, ELISA applications with reactivity to human, mouse, rat samples 33580-1-AP targets LANCL2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, mouse brain tissue, mouse testis tissue, rat brain tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information LanCL2 is a major male germ cell-specific antioxidant gene that is important for testicular homeostasis. Highly expressed in the brain and testis, LanCL2 expression correlates with testicular maturation and brain development. LanCL2 is enriched in spermatocytes and round spermatids of the testis (PMID: 38790639). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38046 Product name: Recombinant human LANCL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-323 aa of BC070049 Sequence: MGETMSKRLKLHLGGEAEMEERAFVNPFPDYEAAAGALLASGAAEETGCVRPPATPDEPGLPFHQDGKIIHNFIRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYLLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECVTKLLQLQRSVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYVRHKKFRSGNYPSSLSNETDRLVHWCHG Predict reactive species Full Name: LanC lantibiotic synthetase component C-like 2 (bacterial) Calculated Molecular Weight: 450 aa, 51 kDa Observed Molecular Weight: 49 kDa GenBank Accession Number: BC070049 Gene Symbol: LANCL2 Gene ID (NCBI): 55915 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9NS86 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.