Iright
BRAND / VENDOR: Proteintech

Proteintech, 33589-1-AP, SFRS15 Polyclonal antibody

CATALOG NUMBER: 33589-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SFRS15 (33589-1-AP) by Proteintech is a Polyclonal antibody targeting SFRS15 in WB, ELISA applications with reactivity to human samples 33589-1-AP targets SFRS15 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information SCAF4 is an mRNA anti-terminator protein that plays a crucial role in regulating transcription by RNA Polymerase II. It functions by binding to the phosphorylated CTD of Pol II and interacting with splicing factors to suppress premature transcription termination, particularly at genes with complex structures. This activity ensures proper transcriptional readthrough and full-length mRNA production, thereby influencing gene expression critical for cellular homeostasis. Dysregulation of SCAF4-mediated anti-termination is implicated in disrupted mRNA processing and potential disease states. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37951 Product name: Recombinant human SFRS15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 991-1147 aa of BC064990 Sequence: FNSGRDQERFGRRSFGNRVENDRERYGNRNDDRDNSNRDRREWGRRSPDRDRHRDLEERNRRSSGHRDRERDSRDRESRREKEEARGKEKPEVTDRAGGNKTVEPPISQVGNVDTASELEKGVSEAAVLKPSEELPAEATSSVEPEKDSGSAAEAPR Predict reactive species Full Name: splicing factor, arginine/serine-rich 15 Observed Molecular Weight: 150 kDa GenBank Accession Number: BC064990 Gene Symbol: SFRS15 Gene ID (NCBI): 57466 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O95104 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924