Iright
BRAND / VENDOR: Proteintech

Proteintech, 33600-1-AP, CCDC63 Polyclonal antibody

CATALOG NUMBER: 33600-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CCDC63 (33600-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC63 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 33600-1-AP targets CCDC63 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Positive IP detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information CCDC63 (Coiled-Coil Domain Containing 63) is a highly conserved centrosomal satellite protein whose main functions are closely related to cell mitosis and ciliogenesis. This protein directly interacts with PCM1, a key organizer of centrosomal satellites, through its coiled-coil domain and is recruited to the pericentriolar material. As an important component of centrosomal satellites, CCDC63 is involved in regulating the normal assembly of the centrosome, microtubule anchoring, and proper orientation of the spindle, thereby ensuring the fidelity of chromosome segregation and genomic stability. Therefore, CCDC63 is one of the core molecules that maintain the accuracy of cell division and the function of organelles. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag39252 Product name: Recombinant human CCDC63 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of NM_152591.2 Sequence: MSVLKKNRRKDSDTPQEPSEKAKEQQAEAELRKLRQQFRKMVESRKSFKFRNQQKIASQYKEIKTLKTEQDEITLLLSLMKSSRNMNRSEKNYMELRLLLQTKEDYEALIKSLKVLLAELDEKILQMEKKIANQKQIFAKMQEANNPRKLQKQIHILETRLNLVTVHFDKMLTTNAKLRKEIEDLRFEKAAYDNVYQQLQ Predict reactive species Full Name: coiled-coil domain containing 63 Calculated Molecular Weight: 66kDa,563aa Observed Molecular Weight: 65 kDa GenBank Accession Number: NM_152591.2 Gene Symbol: CCDC63 Gene ID (NCBI): 160762 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8NA47 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924