Proteintech, 33601-1-AP, TMEM155 Polyclonal antibody

Size: 20ul / 150ul The TMEM155 (33601-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM155 in WB, IP, ELISA applications with reactivity to human, mouse, rat, pig samples 33601-1-AP targets TMEM155 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue, pig brain tissue Positive IP detected in: mouse brain tissue, pig brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag39858 Product name: Recombinant human TMEM155 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-63 aa of NM_001384332.1 Sequence: MEWELNLLLYLALFFFLLFLLFLLLFVVIKQLKNSVANTAGALQPGRLSVHREPWGFSREQAV Predict reactive species Full Name: transmembrane protein 155 Calculated Molecular Weight: 7 kDa，63aa Observed Molecular Weight: 10-15 kDa GenBank Accession Number: NM_001384332.1 Gene Symbol: TMEM155 Gene ID (NCBI): 132332 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q4W5P6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.