Iright
BRAND / VENDOR: Proteintech

Proteintech, 33639-1-AP, GGA3 Polyclonal antibody

CATALOG NUMBER: 33639-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GGA3 (33639-1-AP) by Proteintech is a Polyclonal antibody targeting GGA3 in WB, IF/ICC, ELISA applications with reactivity to human samples 33639-1-AP targets GGA3 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, Calu-1 cells, SH-SY5Y cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Golgi-associated, gamma-adaptin ear-containing, ARF-binding protein 3 (GGA3) is a monomeric clathrin adaptor that localizes predominantly to the trans-Golgi network (TGN) and endosomal membranes. Beyond classical cargo sorting, GGA3 participates in receptor recycling, retrograde transport and signal termination. Notably, caspase-3 cleaves GGA3 during apoptosis or cerebral ischaemia; loss of this adaptor stabilises β-secretase (BACE1), thereby increasing amyloid-β production and linking GGA3 to Alzheimer disease pathogenesis. Recent work further implicates GGA3 in oncogenic processes: in non-small-cell lung cancer it supports TrkA trafficking to the plasma membrane, prolonging Akt/ERK signalling and promoting cell survival.(PMID: 39267722, PMID: 37586201) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38658 Product name: Recombinant human GGA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 363-550 aa of NM_138619.3 Sequence: SGPPRSRSSSQAEATLGPSSTSNALSWLDEELLCLGLADPAPNVPPKESAGNSQWHLLQREQSDLDFFSPRPGTAACGASDAPLLQPSAPSSSSSQAPLPPPFPAPVVPASVPAPSAGSSLFSTGVAPALAPKVEPAVPGHHGLALGNSALHHLDALDQLLEEAKVTSGLVKPTTSPLIPTTTPARPL Predict reactive species Full Name: golgi associated, gamma adaptin ear containing, ARF binding protein 3 Calculated Molecular Weight: 78kDa,723aa Observed Molecular Weight: 90 kDa GenBank Accession Number: NM_138619.3 Gene Symbol: GGA3 Gene ID (NCBI): 23163 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9NZ52 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924