Iright
BRAND / VENDOR: Proteintech

Proteintech, 33696-1-AP, HSPA12A Polyclonal antibody

CATALOG NUMBER: 33696-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HSPA12A (33696-1-AP) by Proteintech is a Polyclonal antibody targeting HSPA12A in WB, ELISA applications with reactivity to human, mouse, rat samples 33696-1-AP targets HSPA12A in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: fetal human brain tissue, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Heat shock protein A12A (HSPA12A) is a distant member of the HSP70 family, which is widely expressed with highest levels in brain, kidney and muscle (PMID: 12552099). HSPA12A encodes a prosurvival pathway against endotoxemic liver injury. Particularly, glycolytic activity in cancer cells is regulated by HSPA12A. HSPA12A modulates glycolysis-derived lactate to affect HMGB1 lactylation and secretion from hepatocytes, by which changes macrophage chemotaxis and activation, and finally affects LI/R injury (PMID: 37441587). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36620 Product name: Recombinant human HSPA12A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 516-675 aa of BC156889 Sequence: PPEKLLVKDGTRWCTDVFDKFISADQSVALGELVKRSYTPAKPSQLVIVINIYSSEHDNVSFITDPGVKKCGTLRLDLTGTSGTAVPARREIQTLMQFGDTEIKATAIDIATSKSVKVGIDFLNY Predict reactive species Full Name: heat shock 70kDa protein 12A Calculated Molecular Weight: 675 aa, 75 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC156889 Gene Symbol: HSPA12A Gene ID (NCBI): 259217 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O43301 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924