Iright
BRAND / VENDOR: Proteintech

Proteintech, 33714-1-AP, IL-27A p28 Polyclonal antibody

CATALOG NUMBER: 33714-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IL-27A p28 (33714-1-AP) by Proteintech is a Polyclonal antibody targeting IL-27A p28 in WB, ELISA applications with reactivity to rat samples 33714-1-AP targets IL-27A p28 in WB, ELISA applications and shows reactivity with rat samples. Tested Applications Positive WB detected in: Recombinant protein Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information L-27, as a member of the IL-6/IL-12 family, is a heterodimeric cytokine composed of two subunits: p28 (IL-27a) and EBI3 (IL-27b). IL-27 acts on various cell types, including T cells, B cells, macrophages, dendritic cells, natural killer (NK) cells and non-hematopoietic cells. IL-27 plays a critical role in the early regulation of T helper type 1 initiation, and enhances proliferation of naive CD4+T cells and naive B cells. It, however, also exerts anti-inflammatory functions by inhibiting the development of Th17 cells and inducing IL-10 producing type 1 regulatory T cells. IL-27 is a potentially promising cytokine for therapeutic approaches on various human diseases. Specification Tested Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg6264 Product name: Recombinant rat IL27A/IL27 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 29-234 aa of / Sequence: FPADPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPVGHHLPNVSLTFQAWRHLSDSDRLCFLATTLRPFPALLGGLETQRTWTSSEREQLWAMRLDLRDLHRHLRFQVLAVGFSCSEEEKEEEEEDEEEEEGKELLLGALGGPNQVSSQVSWPQLLYAYQLLHSLELVLSRAVRDLLLLSLPRRPDSACDP Predict reactive species Full Name: interleukin 27 Calculated Molecular Weight: 27 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: / Gene Symbol: Il27 Gene ID (NCBI): 365368 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: A6I997 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924