Iright
BRAND / VENDOR: Proteintech

Proteintech, 33739-1-AP, WDHD1 Polyclonal antibody

CATALOG NUMBER: 33739-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The WDHD1 (33739-1-AP) by Proteintech is a Polyclonal antibody targeting WDHD1 in WB, ELISA applications with reactivity to human, mouse samples 33739-1-AP targets WDHD1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A431 cells, A549 cells, Calu-1 cells, MCF-7 cells, MDA-MB-231 cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information The WD repeat and HMG-box DNA-binding protein 1 (WDHD1), also known as acidic nucleoplasmic DNA-binding protein 1 (AND-1), is a DNA‐binding protein with a total molecular weight of 126 kDa, containing multiple N-terminal WD40 domains and a C-terminal high mobility group (HMG) box. WDHD1 contains the highly conserved SepB domain, which plays a crucial role in DNA replication processes(PMID: 37569867). WDHD1 regulates the assembly and activation of the pre‐replication complex (pre-RC), and WDHD1 depletion leads to G1 stagnation and delays progression to the S phase(PMID: 36345604). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38697 Product name: Recombinant human WDHD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 950-1129 aa of NM_007086.3 Sequence: SRTTNNEKSPIIKPLIPKPKPKQASAASYFQKRNSQTNKTEEVKEENLKNVLSETPAICPPQNTENQRPKTGFQMWLEENRSNILSDNPDFSDEADIIKEGMIRFRVLSTEERKVWANKAKGETASEGTEAKKRKRVVDESDETENQEEKAKENLNLSKKQKPLDFSTNQKLSAFAFKQE* Predict reactive species Full Name: WD repeat and HMG-box DNA binding protein 1 Calculated Molecular Weight: 126kDa,1129aa Observed Molecular Weight: 126 kDa GenBank Accession Number: NM_007086.3 Gene Symbol: WDHD1 Gene ID (NCBI): 11169 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O75717 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924