Iright
BRAND / VENDOR: Proteintech

Proteintech, 33755-1-AP, SLC35A5 Polyclonal antibody

CATALOG NUMBER: 33755-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC35A5 (33755-1-AP) by Proteintech is a Polyclonal antibody targeting SLC35A5 in WB, ELISA applications with reactivity to human samples 33755-1-AP targets SLC35A5 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: DU 145 cells, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Solute carrier family 35 member A5 (SLC35A5) is a member of the SLC35A protein subfamily comprising nucleotide sugar transporters. SLC35A5 is the sole member of the SLC35 family that contains several diacidic motifs within its cytosolically exposed C-terminus, some of which might be capable of UDP-sugar binding (PMID: 30641943). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8748 Product name: Recombinant human SLC35A5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 171-424 aa of BC005207 Sequence: LQHNLAGRGFHHDAFFSPSNSCLLFRSECPRKDNCTAKEWTFPEAKWNTTARVFSHIRLGMGHVLIIVQCFISSMAIIYNEKILKEGNQLTESIFIQNSKLYFFGILFNGLTLGLQRSNRDQIKNCGFFYGHSAFSVALIFVTAFQGLSVAFILKFLDNMFHVLMAQVTTVIITTVSVLVFDFRPSLEFFLEAPSVLLSIFIYNASKPQVPEYAPRQERIRDLSGNLWERSSGDGEELERLTKPKSDESDEDTF Predict reactive species Full Name: solute carrier family 35, member A5 Calculated Molecular Weight: 424 aa, 49 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC005207 Gene Symbol: SLC35A5 Gene ID (NCBI): 55032 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9BS91 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924