Iright
BRAND / VENDOR: Proteintech

Proteintech, 33767-1-AP, NPY6R Polyclonal antibody

CATALOG NUMBER: 33767-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NPY6R (33767-1-AP) by Proteintech is a Polyclonal antibody targeting NPY6R in IHC, ELISA applications with reactivity to human, mouse samples 33767-1-AP targets NPY6R in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human kidney tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Neuropeptide Y Receptor Y6 (NPY6R, also known as the Y6 receptor) is a member of the neuropeptide Y (NPY) receptor family and belongs to the G protein-coupled receptor (GPCR) class. NPY is an abundant neuropeptide widely distributed in both the central and peripheral nervous systems of mammals, involved in regulating various physiological processes such as feeding, energy balance, emotion, stress response, and cardiovascular function. Notably, the function of NPY6R in humans remains incompletely understood, and it is considered a pseudogene in the human genome, with its encoded protein likely lacking full functionality. Despite this, research on the gene structure of NPY6R and its functional homologs in other species (such as mice) still provides important insights into the evolution of the NPY signaling system, ligand-receptor interactions, and the underlying mechanisms of related diseases. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36876 Product name: Recombinant human NPY6R protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-83 aa of AAB19187 Sequence: MEVSLNHPASNTTSTKNNNSAFFYFESCQPPSPALLLLCIAYTVVLIVGLFGNLSLIIIIFKKQRKAQNFTSILIANLSLSDT Predict reactive species Full Name: neuropeptide Y receptor Y6 (pseudogene) Observed Molecular Weight: 33 kDa GenBank Accession Number: AAB19187 Gene Symbol: NPY6R Gene ID (NCBI): 4888 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924